Anti-IGF1 Antibody
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to IGF1.
Applications:WB, IHC, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Rat, Immunogen:A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGF1 (NP_000609.1), Product form:Liquid, Molecular weight:18 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal, Sequence:PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKN, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:500-1:2,000, IHC: 1:50-1:100, Target:IGF1
+25° C.
Additional Information
Product Code | |
---|---|
Origin | USA |
BTN - HC | |
Size | |
KGS | |
Shipping Conditions |