Anti-SLC6A14 Antibody
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to SLC6A14.
Applications:WB, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 131-234 of human SLC6A14 (NP_009162.1), Product form:Liquid, Molecular weight:72 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300, Sequence:YYNVIIAYSLYYMFASFQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETGV, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:500-1:1,000, Target:SLC6A14
+25° C.
