NRG1 Human
The prices will be displayed on the checkout.
Heregulin-B2 Human Recombinant
Host:Product form:Sterile Filtered White lyophilized (freeze-dried) powder, Source:Escherichia Coli, Purity:Greater than 96.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE, Formulation:Lyophilized from a 0.2µm filtered solution in 20mM PB, pH 7.4, containing 150mM NaCl, Sequence:SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKAEELYQ, Storage:Lyophilized NRG1 although stable at room temperature for 3 weeks, should be stored desiccated below -18?C. Upon reconstitution Heregulin should be stored at 4?C between 2-7 days and for future use below -18?C.Please prevent freeze-thaw cycles, Target:NRG1
+25° C.
