Anti-F4 / 80 Antibody
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to F4 / 80.
Applications:WB, ICC/IF, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Rat, Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 477-596 of human EMR1 (NP_001965.3), Product form:Liquid, Molecular weight:160 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal, Sequence:GVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLKMNSRVVGGIMTGEKKDGFSDPIIYTLENIQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTICSCNQMANLAVIMASGEL, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:100-1:500, ICC/IF: 1:50-1:200, Target:F4 / 80
+25° C.
Additional Information
| Product Code | |
|---|---|
| Origin | USA |
| BTN - HC | |
| Size | |
| KGS | |
| Shipping Conditions |
