Anti-GFP Antibody [1F1]
The prices will be displayed on the checkout.
Mouse monoclonal (1F1) antibody to GFP.
Applications:WB, ICC/IF, IHC, Host:Mouse, Clonality:Monoclonal, Clone ID:1F1, Isotype:IgM, Conjugate:Unconjugated, Immunogen:Recombinant Aequoria coerulescens GFP protein, expressed in and purified from E. coli, Concentration:1 mg/ml, Product form:Liquid, Molecular weight:27 kDa, Formulation:Supplied in Phosphate Buffered Saline with 50% Glycerol and 5mM Sodium Azide, Sequence:MVSKGAELFTGIVPILIELNGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLSYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFEDDGNYKSRAEVKFEGDTLVNRIELTGTDFKEDGNILGNKMEYNYNAHNVYIMTDKAKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMIYFGFVTAAAITHGMDELYK, Purification:Immunogen affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:1,000, ICC/IF: 1:1,000, Target:GFP
+25° C.
Additional Information
| Product Code | |
|---|---|
| Origin | USA |
| BTN - HC | |
| Size | |
| KGS | |
| Shipping Conditions |
