Anti-GFP Tag Antibody [AMC0483R]
The prices will be displayed on the checkout.
Mouse monoclonal [AMC0483R] antibody to GFP Tag.
Applications:WB, ICC/IF, Host:Mouse, Clonality:Monoclonal, Clone ID:AMC0483R, Isotype:IgG1, Conjugate:Unconjugated, Reactivity:Species Independent, Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 to the N-terminus of GFP protein, Product form:Liquid, Molecular weight:26 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300, Light chain:kappa, Sequence:MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFF, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:2,000-1:5,000, ICC/IF: 1:50-1:100, Target:GFP Tag
+25° C.