Anti-Neutrophil Elastase Antibody
The prices will be displayed on the checkout.
Rabbit polyclonal antibody to Neutrophil Elastase.
Applications:WB, IHC, ICC/IF, Host:Rabbit, Clonality:Polyclonal, Isotype:IgG, Conjugate:Unconjugated, Reactivity:Human, Mouse, Rat, Immunogen:A synthetic peptide corresponding to a sequence within amino acids 168-267 of human Neutrophil Elastase (ELANE) (NP_001963.1), Product form:Liquid, Molecular weight:30 kDa, Formulation:Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300, Sequence:VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH, Purification:Affinity purification, Storage:Shipped at 4?C. Upon delivery aliquot and store at -20?C. Avoid freeze / thaw cycles, Recommended dilutions:WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200, Target:Neutrophil Elastase
+25° C.