Protein G
The prices will be displayed on the checkout.
Protein G Recombinant
Host:Product form:Sterile Filtered White lyophilized (freeze-dried) powder, Source:Escherichia Coli, Purity:>96% as determined by SDS-PAGE and RP-HPLC, Formulation:Lyophilized white powder containing no additives, Sequence:LPKTDTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE, Storage:Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Protein G should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles, Target:Protein G
+25° C.
Additional Information
Product Code | |
---|---|
Origin | USA |
BTN - HC | |
Size | |
KGS | |
Shipping Conditions |